Articles with public access mandates - Louis Vermeulen MD PhDLearn more
OverallKWFEuropean CommissionZonMwWorldwide Cancer Research, UKCancer Research UKNWONIHNIHRMRCResearch Grants Council, Hong KongFWOWellcomeNSFCDSTAcademy of Medical Sciences, UKFondazione CariploRCNGovernment of SpainNMRCGovernment of ItalySNSFDoDVAHHMIFWFNHMRCCIHRFRQSNSERCINSERMNERCV Foundation, USABrain Tumour Charity, UK
Not available anywhere: 7
Stem cell dynamics in homeostasis and cancer of the intestine
L Vermeulen, HJ Snippert
Nature Reviews Cancer 14 (7), 468-480, 2014
Mandates: Dutch Cancer Society
Apc-mutant cells act as supercompetitors in intestinal tumour initiation
SM van Neerven, NE de Groot, LE Nijman, BP Scicluna, MS van Driel, ...
Nature 594 (7863), 436-441, 2021
Mandates: Netherlands Organisation for Scientific Research, Worldwide Cancer Research …
Molecular subtypes in cancers of the gastrointestinal tract
MF Bijlsma, A Sadanandam, P Tan, L Vermeulen
Nature reviews Gastroenterology & hepatology 14 (6), 333-342, 2017
Mandates: US National Institutes of Health, National Institute for Health Research, UK …
Cell competition in development, homeostasis and cancer
SM van Neerven, L Vermeulen
Nature Reviews Molecular Cell Biology 24 (3), 221-236, 2023
Mandates: European Commission, Netherlands Organisation for Health Research and …
Classification of colorectal cancer in molecular subtypes by immunohistochemistry
S Ten Hoorn, A Trinh, J de Jong, L Koens, L Vermeulen
Colorectal Cancer: Methods and Protocols, 179-191, 2018
Mandates: Netherlands Organisation for Scientific Research, Worldwide Cancer Research …
A marker-independent lineage-tracing system to quantify clonal dynamics and stem cell functionality in cancer tissue
KJ Lenos, SC Lodestijn, SK Lyons, MF Bijlsma, DM Miedema, ...
Nature protocols 14 (9), 2648-2671, 2019
Mandates: Cancer Research UK, Worldwide Cancer Research, UK, European Commission …
A Cancer Stem Cell Perspective on Minimal Residual Disease in Solid Malignancies
M van der Heijden, L Vermeulen
Cancer Stem Cell Resistance to Targeted Therapy, 31-49, 2019
Mandates: European Commission, Netherlands Organisation for Health Research and …
Available somewhere: 100
The consensus molecular subtypes of colorectal cancer
J Guinney, R Dienstmann, X Wang, A De Reynies, A Schlicker, ...
Nature medicine 21 (11), 1350-1356, 2015
Mandates: US National Institutes of Health, Research Foundation (Flanders), Worldwide …
Consensus molecular subtypes and the evolution of precision medicine in colorectal cancer
R Dienstmann, L Vermeulen, J Guinney, S Kopetz, S Tejpar, J Tabernero
Nature reviews cancer 17 (2), 79-92, 2017
Mandates: US National Institutes of Health, Research Foundation (Flanders), European …
Poor-prognosis colon cancer is defined by a molecularly distinct subtype and develops from serrated precursor lesions
F De Sousa E Melo, X Wang, M Jansen, E Fessler, A Trinh, ...
Nature medicine 19 (5), 614-618, 2013
Mandates: Cancer Research UK, Dutch Cancer Society
Intestinal label-retaining cells are secretory precursors expressing Lgr5
SJA Buczacki, HI Zecchini, AM Nicholson, R Russell, L Vermeulen, ...
Nature 495 (7439), 65-69, 2013
Mandates: Cancer Research UK, Dutch Cancer Society
From tumour heterogeneity to advances in precision treatment of colorectal cancer
CJA Punt, M Koopman, L Vermeulen
Nature reviews Clinical oncology 14 (4), 235-246, 2017
Mandates: Netherlands Organisation for Scientific Research, Worldwide Cancer Research …
Defining stem cell dynamics in models of intestinal tumor initiation
L Vermeulen, E Morrissey, M Van Der Heijden, AM Nicholson, A Sottoriva, ...
Science 342 (6161), 995-998, 2013
Mandates: US National Institutes of Health, Cancer Research UK, Dutch Cancer Society
Assessing the carcinogenic potential of low-dose exposures to chemical mixtures in the environment: the challenge ahead
WH Goodson III, L Lowe, DO Carpenter, M Gilbertson, A Manaf Ali, ...
Carcinogenesis 36 (Suppl_1), S254-S296, 2015
Mandates: US National Institutes of Health, US Department of Veterans Affairs, Howard …
Somatic POLE proofreading domain mutation, immune response, and prognosis in colorectal cancer: a retrospective, pooled biomarker study
E Domingo, L Freeman-Mills, E Rayner, M Glaire, S Briggs, L Vermeulen, ...
The lancet Gastroenterology & hepatology 1 (3), 207-216, 2016
Mandates: Academy of Medical Sciences, UK, Cancer Research UK, National Institute for …
Continuous clonal labeling reveals small numbers of functional stem cells in intestinal crypts and adenomas
S Kozar, E Morrissey, AM Nicholson, M van der Heijden, HI Zecchini, ...
Cell stem cell 13 (5), 626-633, 2013
Mandates: Cancer Research UK, Dutch Cancer Society
Wnt signaling in cancer stem cell biology
F De Sousa e Melo, L Vermeulen
Cancers 8 (7), 60, 2016
Mandates: Netherlands Organisation for Scientific Research, Worldwide Cancer Research …
Cancer stem cell tumor model reveals invasive morphology and increased phenotypical heterogeneity
A Sottoriva, JJC Verhoeff, T Borovski, SK McWeeney, L Naumov, ...
Cancer research 70 (1), 46-56, 2010
Mandates: US National Institutes of Health
Colorectal cancer heterogeneity and targeted therapy: a case for molecular disease subtypes
JF Linnekamp, X Wang, JP Medema, L Vermeulen
Cancer research 75 (2), 245-249, 2015
Mandates: Worldwide Cancer Research, UK, Dutch Cancer Society
Consensus molecular subtypes of colorectal cancer are recapitulated in in vitro and in vivo models
JF Linnekamp, SR Hooff, PR Prasetyanti, R Kandimalla, JY Buikhuisen, ...
Cell Death & Differentiation 25 (3), 616-633, 2018
Mandates: Netherlands Organisation for Scientific Research, Dutch Cancer Society
Publication and funding information is determined automatically by a computer program