Articles with public access mandates - Andrew W. HowardLearn more
OverallNASANSFNSERCEuropean CommissionARCGovernment of SpainSTFCOTKADOEGBMFDNRFCASSNSFDFGFCTNSFCDFFFRQNTSNSANIHFNRSANRNKFIFWFMTAJSTFWOVillum FoundationResearch Council of LithuaniaSwedish Research CouncilARRSBMBFGovernment of ItalyCarlsberg Foundation DKCIHRHelmholtzICARNWOKnut and Alice Wallenberg FoundationEPSRCNERCResearch Grants Council, Hong KongGovernment of Argentina
Available somewhere: 302
The California-Kepler survey. III. A gap in the radius distribution of small planets
BJ Fulton, EA Petigura, AW Howard, H Isaacson, GW Marcy, PA Cargile, ...
The Astronomical Journal 154 (3), 109, 2017
Mandates: US National Science Foundation, US National Aeronautics and Space …
Transiting exoplanet survey satellite
GR Ricker, JN Winn, R Vanderspek, DW Latham, GÁ Bakos, JL Bean, ...
Journal of Astronomical Telescopes, Instruments, and Systems 1 (1), 014003 …, 2015
Mandates: US National Aeronautics and Space Administration
Supernova 2011fe from an Exploding Carbon-Oxygen White Dwarf Star
PE Nugent, M Sullivan, SB Cenko, RC Thomas, D Kasen, DA Howell, ...
Arxiv preprint arXiv:1110.6201, 2011
Mandates: Government of Spain
Masses, radii, and orbits of small Kepler planets: the transition from gaseous to rocky planets
GW Marcy, H Isaacson, AW Howard, JF Rowe, JM Jenkins, ST Bryson, ...
The Astrophysical Journal Supplement Series 210 (2), 20, 2014
Mandates: Danish National Research Foundation, UK Science and Technology Facilities …
State of the field: extreme precision radial velocities
DA Fischer, G Anglada-Escude, P Arriagada, RV Baluev, JL Bean, ...
Publications of the Astronomical Society of the Pacific 128 (964), 066001, 2016
Mandates: US National Science Foundation, US National Aeronautics and Space …
HAT-P-16b: A 4 Mj Planet Transiting A Bright Star On An Eccentric Orbit
LA Buchhave, GÁ Bakos, JD Hartman, G Torres, G Kovacs, DW Latham, ...
The Astrophysical Journal 720, 1118, 2010
Mandates: Hungarian Scientific Research Fund
The California-Kepler survey. IV. Metal-rich stars host a greater diversity of planets
EA Petigura, GW Marcy, JN Winn, LM Weiss, BJ Fulton, AW Howard, ...
The Astronomical Journal 155 (2), 89, 2018
Mandates: US National Aeronautics and Space Administration, Chinese Academy of Sciences
Fundamental Properties of Kepler Planet-Candidate Host Stars using Asteroseismology
D Huber, WJ Chaplin, J Christensen-Dalsgaard, RL Gilliland, H Kjeldsen, ...
arXiv preprint arXiv:1302.2624, 2013
Mandates: Danish National Research Foundation
The California-Kepler survey. V. Peas in a pod: Planets in a Kepler multi-planet system are similar in size and regularly spaced
LM Weiss, GW Marcy, EA Petigura, BJ Fulton, AW Howard, JN Winn, ...
The Astronomical Journal 155 (1), 48, 2018
Mandates: US National Science Foundation, US National Aeronautics and Space …
Revised stellar properties of Kepler targets for the Q1-17 (DR25) transit detection run
S Mathur, D Huber, NM Batalha, DR Ciardi, FA Bastien, A Bieryla, ...
The Astrophysical Journal Supplement Series 229 (2), 30, 2017
Mandates: US National Aeronautics and Space Administration, Australian Research Council
The California-Kepler Survey. I. High-resolution spectroscopy of 1305 stars hosting Kepler transiting planets
EA Petigura, AW Howard, GW Marcy, JA Johnson, H Isaacson, PA Cargile, ...
The Astronomical Journal 154 (3), 107, 2017
Mandates: US National Science Foundation, US National Aeronautics and Space …
Stellar spin-orbit misalignment in a multiplanet system
D Huber, JA Carter, M Barbieri, A Miglio, KM Deck, DC Fabrycky, ...
Science 342 (6156), 331-334, 2013
Mandates: Swiss National Science Foundation, Danish National Research Foundation, UK …
Kepler-62: a five-planet system with planets of 1.4 and 1.6 Earth radii in the habitable zone
WJ Borucki, E Agol, F Fressin, L Kaltenegger, J Rowe, H Isaacson, ...
Science 340 (6132), 587-590, 2013
Mandates: German Research Foundation, Danish National Research Foundation
Water vapor and clouds on the habitable-zone sub-Neptune exoplanet K2-18b
B Benneke, I Wong, C Piaulet, HA Knutson, J Lothringer, CV Morley, ...
The Astrophysical Journal 887 (1), L14, 2019
Mandates: US National Aeronautics and Space Administration, Natural Sciences and …
A sub-Mercury-sized exoplanet
T Barclay, JF Rowe, JJ Lissauer, D Huber, F Fressin, SB Howell, ...
Nature 494 (7438), 452-454, 2013
Mandates: Danish National Research Foundation
A giant planet undergoing extreme-ultraviolet irradiation by its hot massive-star host
BS Gaudi, KG Stassun, KA Collins, TG Beatty, G Zhou, DW Latham, ...
Nature 546 (7659), 514-518, 2017
Mandates: US National Science Foundation, US National Aeronautics and Space Administration
Hubble Space Telescope near-IR transmission spectroscopy of the super-Earth HD 97658b
HA Knutson, D Dragomir, L Kreidberg, EMR Kempton, PR McCullough, ...
The Astrophysical Journal 794 (2), 155, 2014
Mandates: European Commission
A Neptune-sized transiting planet closely orbiting a 5–10-million-year-old star
TJ David, LA Hillenbrand, EA Petigura, JM Carpenter, IJM Crossfield, ...
Nature 534 (7609), 658-661, 2016
Mandates: US National Science Foundation, US National Aeronautics and Space …
A planet within the debris disk around the pre-main-sequence star AU Microscopii
P Plavchan, T Barclay, J Gagné, P Gao, B Cale, W Matzko, D Dragomir, ...
Nature 582 (7813), 497-500, 2020
Mandates: US National Science Foundation, US National Aeronautics and Space …
The California Legacy Survey. I. A catalog of 178 planets from precision radial velocity monitoring of 719 nearby stars over three decades
LJ Rosenthal, BJ Fulton, LA Hirsch, HT Isaacson, AW Howard, ...
The Astrophysical Journal Supplement Series 255 (1), 8, 2021
Mandates: US National Science Foundation, US National Aeronautics and Space Administration
Publication and funding information is determined automatically by a computer program